Iright
BRAND / VENDOR: Proteintech

Proteintech, 12316-1-AP, ANGPTL2 Polyclonal antibody

CATALOG NUMBER: 12316-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANGPTL2 (12316-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12316-1-AP targets ANGPTL2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: H9C2 cells, 3T3-L1 cells, mouse spleen tissue, mouse heart tissue, mouse small intestine, mouse testis tissue, rat heart tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human colon cancer tissue, human heart tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ANGPTL2 (angiopoietin-like 2), a member of the Angptl protein family, is predominantly secreted from adipose tissue and the heart. ANGPTL2 consists of an N-terminus with a conserved coiled-coil domain, two glycosylation sites and a C-terminus with a conserved fibrinogen-like domain. It is a key adipocyte-derived inflammatory mediator that links obesity to systemic INS resistance. ANGPTL2 may play an important role in the pathogenesis of diabetic glomerulopathy. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2969 Product name: Recombinant human ANGPTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 193-493 aa of BC012368 Sequence: QSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH Predict reactive species Full Name: angiopoietin-like 2 Calculated Molecular Weight: 493 aa, 57 kDa Observed Molecular Weight: 57-64 kDa GenBank Accession Number: BC012368 Gene Symbol: ANGPTL2 Gene ID (NCBI): 23452 RRID: AB_2226307 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924