Iright
BRAND / VENDOR: Proteintech

Proteintech, 12327-1-AP, TWSG1 Polyclonal antibody

CATALOG NUMBER: 12327-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TWSG1 (12327-1-AP) by Proteintech is a Polyclonal antibody targeting TWSG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12327-1-AP targets TWSG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue Positive IHC detected in: mouse brain tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Bone morphogenetic proteins (BMPs) are potent morphogens that are involved in cell fate determination, proliferation, apoptosis and adult tissue homeostasis. Twisted gastrulation (TWSG1) is a secreted BMP binding protein that modulates BMP ligand availability in the extracellular space. Several in vitro studies point toward an important role of TWSG1 in the regulation of the immune system (PMID: 21572028). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2983 Product name: Recombinant human TWSG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-223 aa of BC020490 Sequence: LMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF Predict reactive species Full Name: twisted gastrulation homolog 1 (Drosophila) Calculated Molecular Weight: 223 aa, 25 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC020490 Gene Symbol: TWSG1 Gene ID (NCBI): 57045 RRID: AB_2877845 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZX9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924