Proteintech, 12340-1-AP, RALB Polyclonal antibody

Size: 20ul / 150ul The RALB (12340-1-AP) by Proteintech is a Polyclonal antibody targeting RALB in WB, IHC, ELISA applications with reactivity to human, mouse samples 12340-1-AP targets RALB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Y79 cells, human brain tissue, human lung tissue, mouse brain tissue, mouse lung tissue Positive IHC detected in: human ovary tumor tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, drosophila Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2992 Product name: Recombinant human RALB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-206 aa of BC018163 Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL Predict reactive species Full Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) Calculated Molecular Weight: 206 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC018163 Gene Symbol: RALB Gene ID (NCBI): 5899 RRID: AB_2269253 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11234 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.