Iright
BRAND / VENDOR: Proteintech

Proteintech, 12353-1-AP, TAF12 Polyclonal antibody

CATALOG NUMBER: 12353-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TAF12 (12353-1-AP) by Proteintech is a Polyclonal antibody targeting TAF12 in WB, IP, ELISA applications with reactivity to human, mouse samples 12353-1-AP targets TAF12 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Y79 cells Positive IP detected in: Y79 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TAF12, also named TAF15 or TAF2J, is a TBP-associated factor that is contained in Pol I- and Pol II-specific TBP-TAF complexes, it is also a component of the transcription factor IID (TFIID) complex, which is essential for mediating regulation of RNA polymerase transcription. TAF12 plays a key role in regulating eukaryotic gene expression by directly binding promoters and enhancer-bound transactivator proteins. Likewise, TAF12 recruits Gadd45a and the nucleotide excision repair complex to the promoter of rRNA genes leading to active DNA demethylation. Observed MW of TAF12 is from 14-17 kDa and 17-21 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3017 Product name: Recombinant human TAF12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC011986 Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK Predict reactive species Full Name: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC011986 Gene Symbol: TAF12 Gene ID (NCBI): 6883 RRID: AB_2271582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16514 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924