Iright
BRAND / VENDOR: Proteintech

Proteintech, 12361-1-AP, Hemoglobin Epsilon Polyclonal antibody

CATALOG NUMBER: 12361-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Hemoglobin Epsilon (12361-1-AP) by Proteintech is a Polyclonal antibody targeting Hemoglobin Epsilon in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 12361-1-AP targets Hemoglobin Epsilon in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, K-562 cells, mouse placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information The hemoglobin molecule is a tetramer consisting of two alpha- and two beta-globin-like chains. HBE1 (hemoglobin epsilon chain) is a beta-type chain of hemoglobin predominantly expressed during the embryonic stage (21321359). The HBE1 has been regarded as the best marker for fetal nucleated red blood cells (NRBCs) . This antibody can be used to label and isolate fetal cells from maternal blood and may be useful in prenatal diagnosis (15906407). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3026 Product name: Recombinant human HBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC015537 Sequence: MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH Predict reactive species Full Name: hemoglobin, epsilon 1 Calculated Molecular Weight: 147 aa, 16 kDa Observed Molecular Weight: 12-16 kDa GenBank Accession Number: BC015537 Gene Symbol: HBE1 Gene ID (NCBI): 3046 RRID: AB_2114593 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02100 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924