Proteintech, 12417-1-AP, OSBPL3 Polyclonal antibody

Size: 20ul / 150ul The OSBPL3 (12417-1-AP) by Proteintech is a Polyclonal antibody targeting OSBPL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12417-1-AP targets OSBPL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, K-562 cells, HeLa cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The oxysterol-binding protein-like (OSBPL) protein family includes nine members namely OSBPL2, OSBPL3, OSBPL5, OSBPL6, OSBPL7, OSBPL8, OSBPL9, OSBPL10, and OSBPL11. The OSBPL family proteins (OSBPLs) are located at the membrane to exchange molecules or signals between organelles and function as a necessary transporter. In addition to lipid transport, the OSBPLs are involved in the regulation of the actin cytoskeleton, cell polarity, and cell. Recently, the role of OSBPLs in cancer development has been gradually revealed. Upregulation of OSBPL3 could promote colorectal cancer. (PMID: 36918840) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3044 Product name: Recombinant human OSBPL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC017731 Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA Predict reactive species Full Name: oxysterol binding protein-like 3 Calculated Molecular Weight: 887 aa, 101 kDa Observed Molecular Weight: 95-110 kDa GenBank Accession Number: BC017731 Gene Symbol: OSBPL3 Gene ID (NCBI): 26031 RRID: AB_2156103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4L5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.