Iright
BRAND / VENDOR: Proteintech

Proteintech, 12434-1-AP, STAM Polyclonal antibody

CATALOG NUMBER: 12434-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STAM (12434-1-AP) by Proteintech is a Polyclonal antibody targeting STAM in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12434-1-AP targets STAM in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, Multi-cells, mouse brain tissue, Y79 cells, Jurkat cells, K-562 cells, MCF-7 cells, PC-3 cells, Raji cells, SKOV-3 cells, C2C12 cells Positive IP detected in: PC-3 cells Positive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information STAM, also named as STAM1, belongs to the STAM family. It is involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. STAM may also play a role in T-cell development. It is involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs). Together with HRS, STAM forms ESCRT-0. STAM was originally identified as an adaptor protein involved in cytokine signaling.(PMID:20505072) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3112 Product name: Recombinant human STAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-403 aa of BC030586 Sequence: VNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKPSPS Predict reactive species Full Name: signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC030586 Gene Symbol: STAM Gene ID (NCBI): 8027 RRID: AB_2199965 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92783 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924