Iright
BRAND / VENDOR: Proteintech

Proteintech, 12450-1-AP, TCEB1 Polyclonal antibody

CATALOG NUMBER: 12450-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TCEB1 (12450-1-AP) by Proteintech is a Polyclonal antibody targeting TCEB1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12450-1-AP targets TCEB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TCEB1, also named as RNA polymerase II transcription factor SIII subunit C, belongs to the SKP1 family. It mediates the ubiquitination of ECS-E3 ubiquitin-protein ligase complexes. TCEB1 is overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. TCEB1 also promotes invasion of prostate cancer cells (PMID:18844214). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3087 Product name: Recombinant human TCEB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC013809 Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC Predict reactive species Full Name: transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) Calculated Molecular Weight: 112 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC013809 Gene Symbol: TCEB1 Gene ID (NCBI): 6921 RRID: AB_2201139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15369 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924