Proteintech, 12490-1-AP, USP3 Polyclonal antibody

Size: 20ul / 150ul The USP3 (12490-1-AP) by Proteintech is a Polyclonal antibody targeting USP3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 12490-1-AP targets USP3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells, RAW264.7, HepG2 cells, Jurkat cells Positive IP detected in: mouse liver tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information USP3(Ubiquitin carboxyl-terminal hydrolase 3) belongs to the peptidase C19 family. It may regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. USP3 is implicated as a novel chromatin modifier in the maintenance of genome integrity. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3085 Product name: Recombinant human USP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC018113 Sequence: MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK Predict reactive species Full Name: ubiquitin specific peptidase 3 Calculated Molecular Weight: 520 aa, 59 kDa Observed Molecular Weight: 53-59 kDa GenBank Accession Number: BC018113 Gene Symbol: USP3 Gene ID (NCBI): 9960 RRID: AB_10639042 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6I4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.