Iright
BRAND / VENDOR: Proteintech

Proteintech, 12515-1-AP, NUFIP1 Polyclonal antibody

CATALOG NUMBER: 12515-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUFIP1 (12515-1-AP) by Proteintech is a Polyclonal antibody targeting NUFIP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 12515-1-AP targets NUFIP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A375 cells Positive IP detected in: HeLa cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information Fragile X syndrome, the most common cause of inherited mental retardation, is caused by the absence of FMRP (Fragile X Mental Retardation Protein). FMRP is an RNA binding protein reported to be involved in translational control, notably at postsynaptic sites of protein synthesis as a part of a multiprotein/mRNA complex[PMID:12941608]. NUFIP1 is one of the several FMRP-interacting proteins. NUFIP can act as a pol II-specific basal transcriptional activator in vitro and when ectopically overexpressed in vivo. NUFIP can directly activate promoters by enhancing the ATP-dependent release of hyperphosphorylated form of pol II from open transcription complexes[PMID:15107825]. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3197 Product name: Recombinant human NUFIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-276 aa of BC017745 Sequence: MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV Predict reactive species Full Name: nuclear fragile X mental retardation protein interacting protein 1 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC017745 Gene Symbol: NUFIP1 Gene ID (NCBI): 26747 RRID: AB_2298759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924