Iright
BRAND / VENDOR: Proteintech

Proteintech, 12518-1-AP, MAP17 / PDZK1IP1 Polyclonal antibody

CATALOG NUMBER: 12518-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAP17 / PDZK1IP1 (12518-1-AP) by Proteintech is a Polyclonal antibody targeting MAP17 / PDZK1IP1 in IHC, IF/ICC, ELISA applications with reactivity to human samples 12518-1-AP targets MAP17 / PDZK1IP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PDZK1-interacting protein 1(PDZK1IP1), also known as MAP17, is a membrane-associated protein. MAP17 / PDZK1IP1 is overexpressed in a variety of human carcinomas, and overexpression of MAP17 / PDZK1IP1 protein is strongly correlated with the progression of prostate and ovarian carcinomas (PMID: 17426052). MAP17 / PDZK1IP1 has been proven to be an oncogene for tumorigenesis and development of papillary thyroid cancer (PTC) (PMID: 36057192; PMID: 35727731). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3206 Product name: Recombinant human PDZK1IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-114 aa of BC012303 Sequence: VPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVKHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM Predict reactive species Full Name: PDZK1 interacting protein 1 Calculated Molecular Weight: 114 aa, 12 kDa GenBank Accession Number: BC012303 Gene Symbol: MAP17 Gene ID (NCBI): 10158 RRID: AB_3085395 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13113 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924