Iright
BRAND / VENDOR: Proteintech

Proteintech, 12532-1-AP, GAGE2D Polyclonal antibody

CATALOG NUMBER: 12532-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GAGE2D (12532-1-AP) by Proteintech is a Polyclonal antibody targeting GAGE2D in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 12532-1-AP targets GAGE2D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, human testis tissue Positive IHC detected in: human liver cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information GAGE2D, also named as GAGE8 and CT4.8, is expressed in testis and tumor tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3230 Product name: Recombinant human GAGE2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC018052 Sequence: MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC Predict reactive species Full Name: G antigen 2D Calculated Molecular Weight: 116 aa, 13 kDa Observed Molecular Weight: 18-22 kDa GenBank Accession Number: BC018052 Gene Symbol: GAGE2D Gene ID (NCBI): 729408 RRID: AB_2877864 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UEU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924