Iright
BRAND / VENDOR: Proteintech

Proteintech, 12538-1-AP, PPIL4 Polyclonal antibody

CATALOG NUMBER: 12538-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPIL4 (12538-1-AP) by Proteintech is a Polyclonal antibody targeting PPIL4 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12538-1-AP targets PPIL4 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HCT 116 cells, mouse kidney tissue, HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Peptidyl-prolyl isomerase (PPIase) catalyzes the interconversion of a specific Pro-imide bond between the cis and trans conformations. PPIL4 belongs to the cyclophilin subgroup of the peptidyl-prolyl cis-trans isomerase (PPIase) protein family (PPIs). It contains an RNA recognition motif and a PPIase-like domain. PPIL4, as an IA susceptibility gene, is a novel and key regulatory molecule in Wnt signaling and vertebrate cerebrovascular development (PMID: 34887573). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3249 Product name: Recombinant human PPIL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 301-492 aa of BC016984 Sequence: MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR Predict reactive species Full Name: peptidylprolyl isomerase (cyclophilin)-like 4 Calculated Molecular Weight: 492 aa, 57 kDa Observed Molecular Weight: 58-65 kDa GenBank Accession Number: BC016984 Gene Symbol: PPIL4 Gene ID (NCBI): 85313 RRID: AB_10644441 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924