Iright
BRAND / VENDOR: Proteintech

Proteintech, 12549-1-AP, RGS17 Polyclonal antibody

CATALOG NUMBER: 12549-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RGS17 (12549-1-AP) by Proteintech is a Polyclonal antibody targeting RGS17 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12549-1-AP targets RGS17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, PC-3 cells, SH-SY5Y cells, mouse brain tissue, mouse lung tissue, MDA-MB-231 cells, NCI-H1299 cells, SK-BR-3 cells Positive IHC detected in: human testis tissue, human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3399 Product name: Recombinant human RGS17 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-210 aa of BC013117 Sequence: MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGSSSES Predict reactive species Full Name: regulator of G-protein signaling 17 Calculated Molecular Weight: 210 aa, 24 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC013117 Gene Symbol: RGS17 Gene ID (NCBI): 26575 RRID: AB_2179954 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UGC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924