Iright
BRAND / VENDOR: Proteintech

Proteintech, 12555-1-AP, Prion protein PrP/CD230 Polyclonal antibody

CATALOG NUMBER: 12555-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Prion protein PrP/CD230 (12555-1-AP) by Proteintech is a Polyclonal antibody targeting Prion protein PrP/CD230 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12555-1-AP targets Prion protein PrP/CD230 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Prion protein (PRNP) is a ubiquitous membrane glycoprotein whose abnormal self-replicating, misfolded form is widely believed to cause several central nervous system disorders, collectively known as Transmissible Spongiform Encephalopathies (TSE). Prion diseases are TSEs, attributed to conformational conversion of the cellular prion protein (PrPC) into an abnormal conformer that accumulates in the brain. The two isoforms, PrPC and PrPS, have the same primary amino acid sequence and only differ in conformation. While PrPC is composed of 42% α-helix and only 3% β-sheet, PrPSc is composed of 30% α-helix and 43% β-sheet. PrPC converts to its pathogenic isoform when the region corresponding to the residues 108-144 fold into β-sheets. PrPC is very soluble in detergents and easily digested by proteases while the PrPSc is insoluble in detergents and resistant to protease digestion. Prion diseases exist in infectious, sporadic, and genetic forms. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3257 Product name: Recombinant human PrP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-240 aa of BC022532 Sequence: SDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYVLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYKRGSSMVLFSSPPV Predict reactive species Full Name: prion protein Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC022532 Gene Symbol: PrP Gene ID (NCBI): 5621 RRID: AB_2237745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04156 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924