Iright
BRAND / VENDOR: Proteintech

Proteintech, 12557-1-AP, PRMT8 Polyclonal antibody

CATALOG NUMBER: 12557-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRMT8 (12557-1-AP) by Proteintech is a Polyclonal antibody targeting PRMT8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12557-1-AP targets PRMT8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Y79 cells Positive IHC detected in: rat brain tissue, human breast cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PRMT8 is a member of arginine methyl transferase (PRMT) family which acts as nuclear receptor coactivators. PRMT8 catalyzes the asymmetric arginine methylation and is involved in cellular differentiation. PRMT8 has several isoforms; the full-length isoform has a brain specific expression pattern and is localized to the plasma membrane; the truncated isoforms display nuclear localization and are expressed more widely. This antibody recognizes all of isoforms of PRMT8. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3166 Product name: Recombinant human PRMT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 95-394 aa of BC022458 Sequence: RTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSQKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR Predict reactive species Full Name: protein arginine methyltransferase 8 Calculated Molecular Weight: 394 aa, 45 kDa Observed Molecular Weight: 43-50 kDa GenBank Accession Number: BC022458 Gene Symbol: PRMT8 Gene ID (NCBI): 56341 RRID: AB_2171964 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924