Iright
BRAND / VENDOR: Proteintech

Proteintech, 12578-1-AP, SULT4A1 Polyclonal antibody

CATALOG NUMBER: 12578-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SULT4A1 (12578-1-AP) by Proteintech is a Polyclonal antibody targeting SULT4A1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12578-1-AP targets SULT4A1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human brain tissue, rat brain Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information SULT4A1, also named as SULTX3, NST, ST4A1, hBR-STL and hBR-STL-1, belongs to the sulfotransferase 1 family. It may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT4A1 displays activity towards L-triiodothyronine, thyroxine, estrone, p-nitrophenol, 2-naphtylamine, and 2-naphtol. It may have a role in the sulfation of drugs and neurotransmitters in the CNS. SULT4A1 is a brain-specific sulfotransferase believed to be involved in the metabolism of neurotransmitters. It is a novel cytosolic sulfotransferase that is primarily expressed in the brain. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3271 Product name: Recombinant human SULT4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-284 aa of BC022459 Sequence: MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL Predict reactive species Full Name: sulfotransferase family 4A, member 1 Calculated Molecular Weight: 284 aa, 33 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC022459 Gene Symbol: SULT4A1 Gene ID (NCBI): 25830 RRID: AB_2197933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BR01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924