Iright
BRAND / VENDOR: Proteintech

Proteintech, 12584-1-AP, THAP1 Polyclonal antibody

CATALOG NUMBER: 12584-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The THAP1 (12584-1-AP) by Proteintech is a Polyclonal antibody targeting THAP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12584-1-AP targets THAP1 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, human brain tissue, HEK-293 cells, HeLa cells, human heart tissue, A375 cells, SGC-7901 cells, mouse brain tissue, mouse heart tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information THAP1 belongs to the THAP1 family. It is a DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. THAP1 may also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis. Mutations in THAP1 have been associated with dystonia 6. THAP1 encodes a transcription factor with mostly unknown targets. It regulates the expression of DYT1 (TOR1A), another dystonia-causing gene. After characterization of the TOR1A promoter, THAP1 binds to the core promoter of TOR1A. Wild type THAP1 represses the expression of TOR1A, whereas dystonia 6-associated mutant THAP1 results in decreased repression of TOR1A. Catalog#12584-1-AP is a rabbit polyclonal antibody raised against full-length of huamn THAP1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3285 Product name: Recombinant human THAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC021721 Sequence: MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA Predict reactive species Full Name: THAP domain containing, apoptosis associated protein 1 Calculated Molecular Weight: 213 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC021721 Gene Symbol: THAP1 Gene ID (NCBI): 55145 RRID: AB_2201672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924