Iright
BRAND / VENDOR: Proteintech

Proteintech, 12647-1-AP, LANCL1 Polyclonal antibody

CATALOG NUMBER: 12647-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LANCL1 (12647-1-AP) by Proteintech is a Polyclonal antibody targeting LANCL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12647-1-AP targets LANCL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LanCL1 ( also known as P40 or GRP69A), is homologous to bacterial lanthionine synthetase C (LanC) family, which is involved in the biosynthesis of antimicrobial peptides (lantibiotics). LanCL1 was identified as a reduced glutathione (GSH)-binding protein and primarily expressed in neural tissues and testis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3361 Product name: Recombinant human LANCL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-399 aa of BC028685 Sequence: TKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL Predict reactive species Full Name: LanC lantibiotic synthetase component C-like 1 (bacterial) Calculated Molecular Weight: 399 aa, 45 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC028685 Gene Symbol: LANCL1 Gene ID (NCBI): 10314 RRID: AB_10638314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924