Proteintech, 12650-2-AP, FHL5 Polyclonal antibody

Size: 20ul / 150ul The FHL5 (12650-2-AP) by Proteintech is a Polyclonal antibody targeting FHL5 in WB, ELISA applications with reactivity to human, mouse samples 12650-2-AP targets FHL5 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3364 Product name: Recombinant human FHL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-284 aa of BC021723 Sequence: YCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI Predict reactive species Full Name: four and a half LIM domains 5 Calculated Molecular Weight: 284 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC021723 Gene Symbol: FHL5 Gene ID (NCBI): 9457 RRID: AB_2104496 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TD97 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.