Iright
BRAND / VENDOR: Proteintech

Proteintech, 12661-1-AP, COG8 Polyclonal antibody

CATALOG NUMBER: 12661-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COG8 (12661-1-AP) by Proteintech is a Polyclonal antibody targeting COG8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12661-1-AP targets COG8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, Raji cells Positive IHC detected in: human ovary cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The conserved oligomeric Golgi (COG) complex is an eight subunit (COG1-8) peripheral Golgi membrane hetero-oligomeric protein complex. The COG complex is organized into lobes A (COG2-4) and B (COG5-7) with COG1 and COG8 bridging these lobes and is thought to play a critical role in vesicle tethering processes (PMID: 17331980). Cog8 localizes exclusively in the Golgi apparatus and is involved in the retrograde Golgi transport of resident proteins responsible for sugar chain (glycan) biosynthesis (PMID: 17220172). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3341 Product name: Recombinant human COG8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-612 aa of BC017492 Sequence: MNSYMLISAPAILGTSNMPAAVPATQPGTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRETLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP Predict reactive species Full Name: component of oligomeric golgi complex 8 Calculated Molecular Weight: 612 aa, 68 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC017492 Gene Symbol: COG8 Gene ID (NCBI): 84342 RRID: AB_2244993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MW5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924