Iright
BRAND / VENDOR: Proteintech

Proteintech, 12694-1-AP, SMG5 Polyclonal antibody

CATALOG NUMBER: 12694-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMG5 (12694-1-AP) by Proteintech is a Polyclonal antibody targeting SMG5 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 12694-1-AP targets SMG5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, Jurkat cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SMG5 is also named EST1-like protein B (EST1B) and LPTS-RP1. SMG5 is a key Nonsense-mediated mRNA decay (NMD) factor, and NMD factor SMG5 is vital for embryonic development (PMID: 39199410). SMG5 plays a role in the degradation of mRNA through the process of nonsense-mediated decay and encodes a protein. SMG5 has been linked to the development of pancreatic cancer and epiphyseal chondrodysplasia among various illnesses (PMID: 36056355). SMG5 is a kind of RNA-binding proteins (RBPs) (PMID: 37936239). In addition, they have been shown to be key regulators of oncogenesis and tumor progression (PMID: 33228611). SMG5 may be a high-risk factor for HCC prognosis (PMID: 33411682). SMG5 promotes HCC cell proliferation and tumor growth. SMG5 has extensive effects on the proliferation, survival, and tumor growth of HCC cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3424 Product name: Recombinant human SMG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 670-1016 aa of BC038296 Sequence: DLIIVCAQSSQSLWNRLSVLLNLLPAAGELQESGLALCPEVQDLLEGCELPDLPSSLLLPEDMALRNLPPLRAAHRRFNFDTDRPLLSTLEESVVRICCIRSFGHFIARLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAQEEARRNRLMRDMAQLRLQLEVSQLEGSLQQPKAQSAMSPYLVPDTQALCHHLPVIRQLATSGRFIVIIPRTVIDGLDLLKKEHPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLAQGAGEEDPSGMVTIITGLPLDNPSVLSGPMQAALQAAAHASVDIKDVLDFYKQWKEIG Predict reactive species Full Name: Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans) Calculated Molecular Weight: 1016 aa, 114 kDa GenBank Accession Number: BC038296 Gene Symbol: SMG5 Gene ID (NCBI): 23381 RRID: AB_2270781 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924