Iright
BRAND / VENDOR: Proteintech

Proteintech, 12697-1-AP, STK38L Polyclonal antibody

CATALOG NUMBER: 12697-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STK38L (12697-1-AP) by Proteintech is a Polyclonal antibody targeting STK38L in WB, IHC, ELISA applications with reactivity to human samples 12697-1-AP targets STK38L in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information STK38L, also named as KIAA0965 and NDR2, belongs to the protein kinase superfamily and AGC Ser/Thr protein kinase family. It is involved in the regulation of structural processes in differentiating and mature neuronal cells. This antibody is specific to STK38L. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3413 Product name: Recombinant human STK38L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-376 aa of BC028603 Sequence: FESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEE Predict reactive species Full Name: serine/threonine kinase 38 like Calculated Molecular Weight: 464 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC028603 Gene Symbol: STK38L Gene ID (NCBI): 23012 RRID: AB_2240003 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2H1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924