Iright
BRAND / VENDOR: Proteintech

Proteintech, 12700-1-AP, KIFAP3 Polyclonal antibody

CATALOG NUMBER: 12700-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIFAP3 (12700-1-AP) by Proteintech is a Polyclonal antibody targeting KIFAP3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12700-1-AP targets KIFAP3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse testis tissue, mouse brain tissue, MCF-7 cells Positive IP detected in: mouse testis tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KIFAP3, also known as KIF3AP or KAP3, is a novel KIF3A/3B-associated protein. It binds to the tail domain of KIF3A/3B and may play a role in regulating the binding of KIF3A/3B to cargoes. Recently it has been reported that mutation within the KIFAP3 gene is associated with decreased KIFAP3 expression and increased survival in sporadic ALS, which makes it a potential target for ALS therapy. KIFAP3 has also been identified as the target of mir-130a. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3394 Product name: Recombinant human KIFAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 491-792 aa of BC028679 Sequence: SQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS Predict reactive species Full Name: kinesin-associated protein 3 Calculated Molecular Weight: 792 aa, 91 kDa Observed Molecular Weight: 91-100 kDa GenBank Accession Number: BC028679 Gene Symbol: KIFAP3 Gene ID (NCBI): 22920 RRID: AB_2132528 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92845 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924