Iright
BRAND / VENDOR: Proteintech

Proteintech, 12704-1-AP, SNAP29 Polyclonal antibody

CATALOG NUMBER: 12704-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SNAP29 (12704-1-AP) by Proteintech is a Polyclonal antibody targeting SNAP29 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12704-1-AP targets SNAP29 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, human kidney tissue, human liver tissue, K-562 cells Positive IP detected in: Jurkat cells Positive IHC detected in: mouse kidney tissue, human kidney tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for the fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. SNAP29 also plays a role in ciliogenesis by regulating membrane fusions. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3382 Product name: Recombinant human SNAP29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC009715 Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL Predict reactive species Full Name: synaptosomal-associated protein, 29kDa Calculated Molecular Weight: 258 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC009715 Gene Symbol: SNAP29 Gene ID (NCBI): 9342 RRID: AB_2192340 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95721 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924