Proteintech, 12708-1-AP, GABRA3 Polyclonal antibody

Size: 20ul / 150ul The GABRA3 (12708-1-AP) by Proteintech is a Polyclonal antibody targeting GABRA3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12708-1-AP targets GABRA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3389 Product name: Recombinant human GABRA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-282 aa of BC028629 Sequence: PGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLPYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQT Predict reactive species Full Name: gamma-aminobutyric acid (GABA) A receptor, alpha 3 Calculated Molecular Weight: 492 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC028629 Gene Symbol: GABRA3 Gene ID (NCBI): 2556 RRID: AB_10640903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P34903 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.