Proteintech, 12723-1-AP, EXOC6 Polyclonal antibody

Size: 20ul / 150ul The EXOC6 (12723-1-AP) by Proteintech is a Polyclonal antibody targeting EXOC6 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12723-1-AP targets EXOC6 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3418 Product name: Recombinant human EXOC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 503-804 aa of BC028395 Sequence: SESLHRSSTEIDDMLRKSTNLLLTRTLSSCLLNLIRKPHIGLTELVQIIINTTHLEQACKYLEDFITNITNISQETVHTTRLYGLSTFKDARHAAEGEIYTKLNQKIDEFVQLADYDWTMSEPDGRASGYLMDLINFLRSIFQVFTHLPGKVAQTACMSACQHLSTSLMQMLLDSELKQISMGAVQQFNLDVIQCELFASSEPVPGFQGDTLQLAFIDLRQLLDLFMVWDWSTYLADYGQPASKYLRVNPNTALTLLEKMKDTSKKNNIFAQFGKNDRDKQKLIETVVKQLRSLVNGMSQHM Predict reactive species Full Name: exocyst complex component 6 Calculated Molecular Weight: 804 aa, 94 kDa Observed Molecular Weight: 94 kDa, 116 kDa GenBank Accession Number: BC028395 Gene Symbol: EXOC6 Gene ID (NCBI): 54536 RRID: AB_10734442 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.