Iright
BRAND / VENDOR: Proteintech

Proteintech, 12748-1-AP, Complement factor H Polyclonal antibody

CATALOG NUMBER: 12748-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Complement factor H (12748-1-AP) by Proteintech is a Polyclonal antibody targeting Complement factor H in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human samples 12748-1-AP targets Complement factor H in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human blood Positive IP detected in: human plasma tissue Positive IHC detected in: human liver cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Complement factor H (CFH) is an abundant plasma glycoprotein that regulates the function of the alternative complement pathway in the fluid phase and on cellular surfaces (PMID: 2963625). Factor H binds to C3b, accelerates the decay of the alternative pathway C3-convertase (C3bBb), and acts as a cofactor for the factor I-mediated proteolytic inactivation of C3b (PMID: 15163532). It plays a critical role in the homeostasis of the complement system in plasma and in the protection of bystander host cells and tissues from damage by complement activation. Abnormalities in factor H have been associated with renal disease (PMID: 18190458). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3482 Product name: Recombinant human CFH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-349 aa of BC037285 Sequence: LPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAV Predict reactive species Full Name: complement factor H Calculated Molecular Weight: 1231 aa, 139 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC037285 Gene Symbol: Complement factor H Gene ID (NCBI): 3075 RRID: AB_10642946 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08603 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924