Iright
BRAND / VENDOR: Proteintech

Proteintech, 12772-1-AP, KRR1 Polyclonal antibody

CATALOG NUMBER: 12772-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KRR1 (12772-1-AP) by Proteintech is a Polyclonal antibody targeting KRR1 in WB, IF/ICC, ELISA applications with reactivity to human samples 12772-1-AP targets KRR1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, human kidney tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KRR1 (also known as RIP-1) is a key assembly factor in the biogenesis of 40S precursor ribosomes (90S). As a rate-limiting node in ribosome biogenesis, its expression level reflects overall ribosome production activity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3464 Product name: Recombinant human KRR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-381 aa of BC026107 Sequence: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK Predict reactive species Full Name: KRR1, small subunit (SSU) processome component, homolog (yeast) Calculated Molecular Weight: 381 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC026107 Gene Symbol: KRR1 Gene ID (NCBI): 11103 RRID: AB_2134283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13601 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924