Iright
BRAND / VENDOR: Proteintech

Proteintech, 12787-1-AP, HMGB4 Polyclonal antibody

CATALOG NUMBER: 12787-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HMGB4 (12787-1-AP) by Proteintech is a Polyclonal antibody targeting HMGB4 in WB, ELISA applications with reactivity to human, mouse samples 12787-1-AP targets HMGB4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information High mobility group protein B4 (HMGB4) is a new member in the family of HMGB proteins. Unlike other HMGB-proteins, it is a mammalian specific protein that has two HMGB-boxes but lacks the acidic tail. HMGB4 is strongly and preferentially expressed in the adult mouse testis and weakly in the brain, but not in many other tissues (PMID: 18987332). It binds strongly to nuclear structures, regulates chromatin and mediates differentiation of neuronal cells (PMID: 27608812). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3503 Product name: Recombinant human HMGB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC021180 Sequence: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPSTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQAPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS Predict reactive species Full Name: high-mobility group box 4 Calculated Molecular Weight: 186 aa, 22 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC021180 Gene Symbol: HMGB4 Gene ID (NCBI): 127540 RRID: AB_10638490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WW32 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924