Iright
BRAND / VENDOR: Proteintech

Proteintech, 12799-1-AP, SMAP1 Polyclonal antibody

CATALOG NUMBER: 12799-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMAP1 (12799-1-AP) by Proteintech is a Polyclonal antibody targeting SMAP1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12799-1-AP targets SMAP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human adrenal gland tissue, human plasma sample, mouse brain tissue, rat lymph tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information SMAP1, also named as FLJ13159 and SMAP 1, contains a Arf-GAP domain. SMAP1 is a GTPase activating protein for ARF6 that binds clathrin and regulates clathrin-dependent endocytosis. SMAP1 may play a role in erythropoiesis. This antibody is a rabbit polyclonal antibody raised against residues near the N terminus of human SMAP1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3544 Product name: Recombinant human SMAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC036123 Sequence: MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTE Predict reactive species Full Name: small ArfGAP 1 Calculated Molecular Weight: 467 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC036123 Gene Symbol: SMAP1 Gene ID (NCBI): 60682 RRID: AB_2272651 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924