Iright
BRAND / VENDOR: Proteintech

Proteintech, 12800-1-AP, TPRKB Polyclonal antibody

CATALOG NUMBER: 12800-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TPRKB (12800-1-AP) by Proteintech is a Polyclonal antibody targeting TPRKB in WB, ELISA applications with reactivity to human, mouse, rat samples 12800-1-AP targets TPRKB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TPRKB, also named as CGI 121, belongs to the CGI121/TPRKB family. It interacts with TP53RK/PRPK and is widely expressed in all tissues. This antibody is a rabbit polyclonal antibody raised against full length TPRKB of human origin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3551 Product name: Recombinant human TPRKB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC029492 Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL Predict reactive species Full Name: TP53RK binding protein Calculated Molecular Weight: 175 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC029492 Gene Symbol: TPRKB Gene ID (NCBI): 51002 RRID: AB_2256289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3C4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924