Proteintech, 12801-1-AP, GATM Polyclonal antibody

Size: 20ul / 150ul The GATM (12801-1-AP) by Proteintech is a Polyclonal antibody targeting GATM in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12801-1-AP targets GATM in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, human kidney tissue, rat kidney tissue, rat pancreas tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GATM, also known as AGAT, produces ornithine and guanidinoacetate (GAA) from arginine and glycine, and is a key enzyme for creatine synthesis. GATM deficiency in early infancy causes neurodevelopmental delay. GATM is predominantly expressed in kidney and pancreas in adults. Decrease of GAMT proteins was observed in proximal tubule damage cases, which links GATM as a general marker for proximal tubule damage. Alternative splicing of GATM generates three isoforms with molecular weights between 44 kDa to 48 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3754 Product name: Recombinant human GATM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 74-423 aa of BC004141 Sequence: PLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD Predict reactive species Full Name: glycine amidinotransferase (L-arginine:glycine amidinotransferase) Calculated Molecular Weight: 423 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC004141 Gene Symbol: GATM Gene ID (NCBI): 2628 RRID: AB_2109060 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.