Proteintech, 12830-1-AP, XK Polyclonal antibody

Size: 20ul / 150ul The XK (12830-1-AP) by Proteintech is a Polyclonal antibody targeting XK in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12830-1-AP targets XK in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, MCF-7 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:400 Background Information XK, also named as XKR1 and XRG1, is responsible for the Kx blood group system. XK forms a functional complex with the Kell glycoprotein. It represents a crucial factor for the maintenance of normal muscle structure and function. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3550 Product name: Recombinant human XK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-444 aa of BC036019 Sequence: QFFHPCKKLFSSSVSEGFQRWLRCFCWACRQQKPCEPIGKEDLQSSRDRDETPSSSKTSPEPGQFLNAEDLCSA Predict reactive species Full Name: X-linked Kx blood group (McLeod syndrome) Calculated Molecular Weight: 444 aa, 51 kDa Observed Molecular Weight: 45-51 kDa GenBank Accession Number: BC036019 Gene Symbol: XK Gene ID (NCBI): 7504 RRID: AB_2877887 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51811 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.