Proteintech, 12837-2-AP, CD247 Polyclonal antibody

Size: 20ul / 150ul The CD247 (12837-2-AP) by Proteintech is a Polyclonal antibody targeting CD247 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12837-2-AP targets CD247 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, human spleen tissue, mouse spleen tissue Positive IP detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD247, also known as CD3Z (T-cell surface glycoprotein CD3 zeta chain), belongs to the CD3Z/FCER1G family. CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3889 Product name: Recombinant human CD247 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-164 aa of BC025703 Sequence: FLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR Predict reactive species Full Name: CD247 molecule Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC025703 Gene Symbol: CD247 Gene ID (NCBI): 919 RRID: AB_2244279 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20963 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.