Product Description
Size: 20ul / 150ul
The SMARCD3 (12838-1-AP) by Proteintech is a Polyclonal antibody targeting SMARCD3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples
12838-1-AP targets SMARCD3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, BxPC-3 cells, NIH/3T3 cells, C6 cells
Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: human heart tissue, mouse pancreas tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
SMARCD3 is a component of the SWI/SNF (mating type switching/sucrose non-fermenting) chromatin remodeling complex, which evolutionarily conserved from yeast to human, and all complexes contain a core set of conserved components, including BRG1/Brm-associated factors (BAFs) and a DNA-dependent SWI2/SNF2-like ATPase, which enables chromatin remodeling. SMARCD3 isoforms bind to several nuclear receptors and transcription factors of various families. SMARCD3 proteins interact in a ligand-independent manner with peroxisome proliferator- activated receptor gamma and enhance its transcriptional activity.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag3896 Product name: Recombinant human SMARCD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC002628 Sequence: MTPGLQHPPTVVQRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGLAPAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRR Predict reactive species
Full Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Calculated Molecular Weight: 54 kDa
Observed Molecular Weight: 54-55 kDa
GenBank Accession Number: BC002628
Gene Symbol: SMARCD3
Gene ID (NCBI): 6604
RRID: AB_2192157
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6STE5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924