Iright
BRAND / VENDOR: Proteintech

Proteintech, 12858-1-AP, PHYH Polyclonal antibody

CATALOG NUMBER: 12858-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHYH (12858-1-AP) by Proteintech is a Polyclonal antibody targeting PHYH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12858-1-AP targets PHYH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, HEK-293 cells, human kidney tissue, Jurkat cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PHYH (Phytanoyl-CoA 2-hydroxylase), also known as Phytanic acid oxidase or Phytanoyl-CoA alpha-hydroxylase, is a peroxisomal enzyme which converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. It catalyzes the first step in the alpha-oxidation of phytanic acid, a branched-chain fatty acid. Mutations in this gene can cause Refsum disease (RD) and deficient protein activity can cause Zellweger syndrome and rhizomelic chondrodysplasia punctata. This antibody (12858-1-AP) detects two bands: 36kd and 70kd. The 70kd band may probably be the dimeric form of PHYH. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3569 Product name: Recombinant human PHYH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-338 aa of BC029512 Sequence: MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL Predict reactive species Full Name: phytanoyl-CoA 2-hydroxylase Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 36 kDa, 70 kDa GenBank Accession Number: BC029512 Gene Symbol: PHYH Gene ID (NCBI): 5264 RRID: AB_2163745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14832 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924