Proteintech, 12864-1-AP, ALOX5AP Polyclonal antibody

Size: 20ul / 150ul The ALOX5AP (12864-1-AP) by Proteintech is a Polyclonal antibody targeting ALOX5AP in WB, ELISA applications with reactivity to human samples 12864-1-AP targets ALOX5AP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells, human saliva tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3144 Product name: Recombinant human ALOX5AP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC018538 Sequence: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP Predict reactive species Full Name: arachidonate 5-lipoxygenase-activating protein Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC018538 Gene Symbol: ALOX5AP Gene ID (NCBI): 241 RRID: AB_3669149 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20292 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.