Iright
BRAND / VENDOR: Proteintech

Proteintech, 12868-1-AP, TRAF5 Polyclonal antibody

CATALOG NUMBER: 12868-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAF5 (12868-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF5 in WB, ELISA applications with reactivity to human, mouse samples 12868-1-AP targets TRAF5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, PC-3 cells, mouse pancreas tissue, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3519 Product name: Recombinant human TRAF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 209-557 aa of BC029600 Sequence: DEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL Predict reactive species Full Name: TNF receptor-associated factor 5 Calculated Molecular Weight: 557 aa, 64 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC029600 Gene Symbol: TRAF5 Gene ID (NCBI): 7188 RRID: AB_2209712 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00463 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924