Iright
BRAND / VENDOR: Proteintech

Proteintech, 12870-1-AP, HLF Polyclonal antibody

CATALOG NUMBER: 12870-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HLF (12870-1-AP) by Proteintech is a Polyclonal antibody targeting HLF in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12870-1-AP targets HLF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HEK-293 cells, K-562 cells, HepG2 cells, mouse liver tissue, mouse brain tissue Positive IHC detected in: rat liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Hepatic leukemia factor (Hlf), is a novel hepatic protein of the proline and acidic amino acid-rich basic leucine zipper (bZip) family, previously studied for its role in circadian rhythm regulated neurotransmitter metabolism in the brain (PMID: 29166614). HLF is an essential regulator of HSC quiescence and that HLF deficiency leads to an exhaustion of HSCs in adult mouse BM during regeneration or following cytotoxic stress (PMID: 29262330).Hlf is able to bind DNA specifically as a homodimer or as a heterodimer with other PAR factors (PMID: 1516826). Western blot analysis detected bands  33 kDa whereas the 66 kDa could be the dimer form of Hlf. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3533 Product name: Recombinant human HLF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC036093 Sequence: MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL Predict reactive species Full Name: hepatic leukemia factor Calculated Molecular Weight: 295 aa, 33 kDa Observed Molecular Weight: 33kDa, 66 kDa GenBank Accession Number: BC036093 Gene Symbol: HLF Gene ID (NCBI): 3131 RRID: AB_11182935 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924