Proteintech, 12871-1-AP, GABRG1 Polyclonal antibody

Size: 20ul / 150ul The GABRG1 (12871-1-AP) by Proteintech is a Polyclonal antibody targeting GABRG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12871-1-AP targets GABRG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3535 Product name: Recombinant human GABRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-272 aa of BC031087 Sequence: ADDEDDEDLTVNKTWVLAPKIHEGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEITHTISGDYVIMTIFFDLSRRMGY Predict reactive species Full Name: gamma-aminobutyric acid (GABA) A receptor, gamma 1 Calculated Molecular Weight: 465 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC031087 Gene Symbol: GABRG1 Gene ID (NCBI): 2565 RRID: AB_2107274 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N1C3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.