Proteintech, 12876-1-AP, EAAT4 Polyclonal antibody

Size: 20ul / 150ul The EAAT4 (12876-1-AP) by Proteintech is a Polyclonal antibody targeting EAAT4 in WB, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 12876-1-AP targets EAAT4 in WB, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A375 cells Positive IF-Fro detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information Excitatory amino acid transporter 4 (EAAT4) is a neuronal glutamate transporter responsible for the reuptake of synaptically released glutamate. The EAAT4 protein is highly enriched in Purkinje cells of the cerebellum, although it is not restricted to these cells (18770868). While the predicted molecular weight of EAAT4 is 62 kDa, considerable heterogeneity in transporter size has been reported in the brain with molecular weights ranging from 50 to 120 kDa as a result of differential glycosylation and/or phosphorylation (24056007). This antibody recognizes 60-70 kDa of EAAT4 in mouse brain and several other lysate. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3554 Product name: Recombinant human SLC1A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-271 aa of BC028721 Sequence: MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL Predict reactive species Full Name: solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 Calculated Molecular Weight: 61.6 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC028721 Gene Symbol: EAAT4 Gene ID (NCBI): 6511 RRID: AB_10642147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48664 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.