Proteintech, 12880-1-AP, GJB3 Polyclonal antibody

Size: 20ul / 150ul The GJB3 (12880-1-AP) by Proteintech is a Polyclonal antibody targeting GJB3 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 12880-1-AP targets GJB3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse stomach tissue, mouse ovary tissue, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse placenta tissue, human ovary tumor tissue, human cervix tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information GJB3, also known as Connexin-31 (Cx31), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Mutations in the gene of GJB3 have been described in patients with dominant and recessive hearing impairment and in patients with erythrokeratodermia variabilis (EKV). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, marmoset Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3839 Product name: Recombinant human GJB3 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 101-270 aa of BC012918 Sequence: RERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCRCHHKLVEAGEVDPDPGNNKLQASAPNLTPI Predict reactive species Full Name: gap junction protein, beta 3, 31kDa Calculated Molecular Weight: 270 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC012918 Gene Symbol: GJB3 Gene ID (NCBI): 2707 RRID: AB_2110907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75712 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.