Proteintech, 12881-1-AP, LILRB5 Polyclonal antibody

Size: 20ul / 150ul The LILRB5 (12881-1-AP) by Proteintech is a Polyclonal antibody targeting LILRB5 in WB, ELISA applications with reactivity to human samples 12881-1-AP targets LILRB5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3886 Product name: Recombinant human LILRB5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-350 aa of BC025704 Sequence: CVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQI Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5 Calculated Molecular Weight: 590 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC025704 Gene Symbol: LILRB5 Gene ID (NCBI): 10990 RRID: AB_2136648 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75023 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.