Iright
BRAND / VENDOR: Proteintech

Proteintech, 12917-1-AP, PLS3 Polyclonal antibody

CATALOG NUMBER: 12917-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLS3 (12917-1-AP) by Proteintech is a Polyclonal antibody targeting PLS3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12917-1-AP targets PLS3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells Positive IP detected in: A431 cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PLS3, also named T-plastin and Plastin-3, is an actin-bundling protein found in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia. It plays an important role in leukocyte function. L-plastin plays an important role in leukocyte function, and T-plastin is possibly involved in DNA repair. Both T- and L-plastin are implicated in several diseases, and L-plastin is considered to be a valuable marker for cancer (PMID: 15960882). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3574 Product name: Recombinant human PLS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-630 aa of BC039049 Sequence: LENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV Predict reactive species Full Name: plastin 3 (T isoform) Calculated Molecular Weight: 630 aa, 71 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC039049 Gene Symbol: PLS3 Gene ID (NCBI): 5358 RRID: AB_2877892 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13797 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924