Iright
BRAND / VENDOR: Proteintech

Proteintech, 12925-1-AP, NCALD Polyclonal antibody

CATALOG NUMBER: 12925-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NCALD (12925-1-AP) by Proteintech is a Polyclonal antibody targeting NCALD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12925-1-AP targets NCALD in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, A549 cells, mouse cerebellum tissue, human brain tissue, human heart tissue, human cerebellum tissue, rat brain tissue Positive IHC detected in: mouse cerebellum tissue, human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NCALD belongs to the recoverin family. And it is a member of the EF-hand calcium-binding protein superfamily. NCALD may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. It plays an important role in the regulation of the neuronal signal transduction process. NCALD is a likely candidate for conferring susceptibility to diabetic nephropathy. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3614 Product name: Recombinant human NCALD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC036098 Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF Predict reactive species Full Name: neurocalcin delta Calculated Molecular Weight: 193 aa, 22 kDa Observed Molecular Weight: 18-22 kDa GenBank Accession Number: BC036098 Gene Symbol: NCALD Gene ID (NCBI): 83988 RRID: AB_2149410 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61601 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924