Iright
BRAND / VENDOR: Proteintech

Proteintech, 12946-1-AP, VRK2 Polyclonal antibody

CATALOG NUMBER: 12946-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VRK2 (12946-1-AP) by Proteintech is a Polyclonal antibody targeting VRK2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12946-1-AP targets VRK2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, human liver tissue, mouse skeletal muscle tissue, K-562 cells, U2OS cells, BxPC-3 cells Positive IP detected in: K-562 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Vaccinia-related kinase 2 (VRK2) is a serine/threonine kinase that plays a significant role in various cellular processes, including cell survival, proliferation, and DNA damage response. The VRK2 gene is known to produce two main splice variants: VRK2A and VRK2B, with VRK2A being the predominant form in humans. VRK2 is involved in several key biological functions. It is known to enhance cell survival by acting as an anti-apoptotic factor, which is particularly crucial in cancer biology. The overexpression of VRK2 has been linked to increased drug sensitivity in cancer cells, suggesting that this kinase may play a role in therapeutic responses. Additionally, high levels of VRK2 protein have been associated with improved survival rates in specific subgroups of astrocytomas, a type of brain tumor. (PMID: 29872222; 37943248; 24079673) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4019 Product name: Recombinant human VRK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC027854 Sequence: MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDVKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVN Predict reactive species Full Name: vaccinia related kinase 2 Calculated Molecular Weight: 508 aa, 58 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC027854 Gene Symbol: VRK2 Gene ID (NCBI): 7444 RRID: AB_2215681 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86Y07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924