Iright
BRAND / VENDOR: Proteintech

Proteintech, 12989-1-AP, GSPT2 Polyclonal antibody

CATALOG NUMBER: 12989-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSPT2 (12989-1-AP) by Proteintech is a Polyclonal antibody targeting GSPT2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12989-1-AP targets GSPT2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, NIH/3T3 cells, PC-3 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GSPT2, also named as Eukaryotic peptide chain release factor GTP-binding subunit ERF3B or G1 to S phase transition protein 2 homolog, is a 628 amino acid protein, which belongs to the GTP-binding elongation factor family. ERF3 subfamily. GSPT2 localizes in the cytoplasm and is highly expressed in IUCC stage II colorectal cancer (CRC). GSPT2 is involved in translation termination in response to the termination codons UAA, UAG and UGA and may play a role as a potent stimulator of the release factor activity of ETF1. It may play a role in cell cycle progression. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3641 Product name: Recombinant human GSPT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC036077 Sequence: MDSGSSSSDSAPDCWDQVDMESTGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVPSFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENGEVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPK Predict reactive species Full Name: G1 to S phase transition 2 Calculated Molecular Weight: 628 aa, 69 kDa Observed Molecular Weight: 69-75 kDa GenBank Accession Number: BC036077 Gene Symbol: GSPT2 Gene ID (NCBI): 23708 RRID: AB_2115511 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924