Iright
BRAND / VENDOR: Proteintech

Proteintech, 13000-1-AP, DOCK7 Polyclonal antibody

CATALOG NUMBER: 13000-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DOCK7 (13000-1-AP) by Proteintech is a Polyclonal antibody targeting DOCK7 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13000-1-AP targets DOCK7 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HepG2 cells, human brain tissue, mouse brain tissue, mouse ovary tissue, Jurkat cells, HeLa cells, K-562 cells, rat brain tissue Positive IP detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DOCK 7 (dedicator of cytokinesis 7), also known as ZIR2, is a member of the DOCK180-related protein superfamily. Expressed mainly in neuronal cells, DOCK 7 is a guanine nucleotide exchange factor (GEF) for small GTPases, Rac1 and Cdc42, which are the major regulators of actin cytoskeleton. Multiple isoforms of DOCK 7 exist due to alternative splicing events. The DOCK 7 antibody (13000-1-AP) can recognize all the isoforms. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3671 Product name: Recombinant human DOCK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 447-798 aa of BC016392 Sequence: MAGMYEAVNEVYKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL Predict reactive species Full Name: dedicator of cytokinesis 7 Calculated Molecular Weight: 2109 aa, 239 kDa Observed Molecular Weight: 238-243 kDa GenBank Accession Number: BC016392 Gene Symbol: DOCK7 Gene ID (NCBI): 85440 RRID: AB_10646476 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96N67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924