Iright
BRAND / VENDOR: Proteintech

Proteintech, 13019-3-AP, TFAP2A/AP-2 Polyclonal antibody

CATALOG NUMBER: 13019-3-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TFAP2A/AP-2 (13019-3-AP) by Proteintech is a Polyclonal antibody targeting TFAP2A/AP-2 in WB, ELISA applications with reactivity to human samples 13019-3-AP targets TFAP2A/AP-2 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BT-549 cells, HeLa cells, Y79 cells, HEK-293T cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The activator protein-2 (AP-2) family of transcription factors comprises five 52-kDa isoforms (AP-2α, AP-2β, AP-2γ, AP-2δ, and AP-2ε), which share a common structure: a proline/glutamine-rich transactivation domain in the N-terminal region and a helix-span-helix domain in the C-terminal region, which mediates dimerization and site-specific DNA binding. Depending on the cellular context, the AP-2 transcription factors are individually associated either with cell differentiation and development or with cancer progression/regression (PMID: 21966377). TFAP2A (AP-2-alpha) is the only AP-2 protein required for early morphogenesis of the lens vesicle. Together with the CITED2 coactivator, stimulates the PITX2 P1 promoter transcription activation (PMID: 11694877). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4112 Product name: Recombinant human TFAP2A,AP-2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 79-431 aa of BC017754 Sequence: LHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK Predict reactive species Full Name: transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) Calculated Molecular Weight: 431 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC017754 Gene Symbol: TFAP2A/AP-2 Gene ID (NCBI): 7020 RRID: AB_2199414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05549 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924